Dermcidin (DCD) (NM_053283) Human Mass Spec Standard

CAT#: PH309352

DCD MS Standard C13 and N15-labeled recombinant protein (NP_444513)

Product Images

Coomassie blue staining of purified DCD protein (Cat# TP309352). The protein was produced from HEK293T cells transfected with DCD cDNA clone (Cat# RC209352) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209352
• Predicted MW: 11.3 kDa
• Protein Sequence:
  Sequence Link

  >RC209352 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL
  DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_444513
• RefSeq Size: 645
• RefSeq ORF: 330
• Synonyms: AIDD; DCD-1; DSEP; HCAP; PIF
• Locus ID: 117159
• UniProt ID: P81605
• Cytogenetics: 12q13.2
• Summary: This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]
• Protein Families: Secreted Protein