Dermcidin (DCD) (NM_053283) Human Recombinant Protein

CAT#: TP309352

Recombinant protein of human dermcidin (DCD)

Product Images

Coomassie blue staining of purified DCD protein (Cat# TP309352). The protein was produced from HEK293T cells transfected with DCD cDNA clone (Cat# RC209352) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209352 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRFMTLLFLTALAGALVCAYDPEAASAPGSGNPCHEASAAQKENAGEDPGLARQAPKPRKQRSSLLEKGL
  DGAKKAVGGLGKLGKDAVEDLESVGKGAVHDVKDVLDSVL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 9.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_444513
• Locus ID: 117159
• UniProt ID: P81605
• Cytogenetics: 12q13.2
• Refseq Size: 645
• Refseq ORF: 330
• Synonyms: AIDD; DCD-1; DSEP; HCAP; PIF
• Summary: This antimicrobial gene encodes a secreted protein that is subsequently processed into mature peptides of distinct biological activities. The C-terminal peptide is constitutively expressed in sweat and has antibacterial and antifungal activities. The N-terminal peptide, also known as diffusible survival evasion peptide, promotes neural cell survival under conditions of severe oxidative stress. A glycosylated form of the N-terminal peptide may be associated with cachexia (muscle wasting) in cancer patients. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Oct 2014]
• Protein Families: Secreted Protein