Pyrophosphatase 1 (PPA1) (NM_021129) Human Mass Spec Standard

CAT#: PH309393

PPA1 MS Standard C13 and N15-labeled recombinant protein (NP_066952)

Product Images

Coomassie blue staining of purified PPA1 protein (Cat# TP309393). The protein was produced from HEK293T cells transfected with PPA1 cDNA clone (Cat# RC209393) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209393
• Predicted MW: 32.7 kDa
• Protein Sequence:
  Sequence Link

  >RC209393 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIK
  QDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKV
  LGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEF
  KDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDV
  DKWFHHQKN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066952
• RefSeq Size: 1316
• RefSeq ORF: 867
• Synonyms: HEL-S-66p; IOPPP; PP; PP1; SID6-8061
• Locus ID: 5464
• UniProt ID: Q15181, V9HWB5
• Cytogenetics: 10q22.1
• Summary: 'The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. [provided by RefSeq, Jul 2008]'
• Protein Families: ES Cell Differentiation/IPS
• Protein Pathways: Oxidative phosphorylation