Pyrophosphatase 1 (PPA1) (NM_021129) Human Recombinant Protein
CAT#: TP309393
Recombinant protein of human pyrophosphatase (inorganic) 1 (PPA1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209393 protein sequence
Red=Cloning site Green=Tags(s) MSGFSTEERAAPFSLEYRVFLKNEKGQYISPFHDIPIYADKDVFHMVVEVPRWSNAKMEIATKDPLNPIK QDVKKGKLRYVANLFPYKGYIWNYGAIPQTWEDPGHNDKHTGCCGDNDPIDVCEIGSKVCARGEIIGVKV LGILAMIDEGETDWKVIAINVDDPDAANYNDINDVKRLKPGYLEATVDWFRRYKVPDGKPENEFAFNAEF KDKDFAIDIIKSTHDHWKALVTKKTNGKGISCMNTTLSESPFKCDPDAARAIVDALPPPCESACTVPTDV DKWFHHQKN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 32.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_066952 |
Locus ID | 5464 |
UniProt ID | Q15181, V9HWB5 |
Cytogenetics | 10q22.1 |
Refseq Size | 1316 |
Refseq ORF | 867 |
Synonyms | HEL-S-66p; IOPPP; PP; PP1; SID6-8061 |
Summary | The protein encoded by this gene is a member of the inorganic pyrophosphatase (PPase) family. PPases catalyze the hydrolysis of pyrophosphate to inorganic phosphate, which is important for the phosphate metabolism of cells. Studies of a similar protein in bovine suggested a cytoplasmic localization of this enzyme. [provided by RefSeq, Jul 2008] |
Protein Families | ES Cell Differentiation/IPS |
Protein Pathways | Oxidative phosphorylation |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412068 | PPA1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY412068 | Transient overexpression lysate of pyrophosphatase (inorganic) 1 (PPA1) |
USD 325.00 |
|
PH309393 | PPA1 MS Standard C13 and N15-labeled recombinant protein (NP_066952) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review