TINAGL1 (NM_022164) Human Mass Spec Standard

CAT#: PH309508

TINAGL1 MS Standard C13 and N15-labeled recombinant protein (NP_071447)

Product Images

Coomassie blue staining of purified TINAGL1 protein (Cat# TP309508). The protein was produced from HEK293T cells transfected with TINAGL1 cDNA clone (Cat# RC209508) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209508
• Predicted MW: 52.4 kDa
• Protein Sequence:
  Sequence Link

  >RC209508 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWRCPLGLLLLLPLAGHLALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAI
  CYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDNCNRCTCQENRQWQCDQEPC
  LVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEAS
  EKWPNLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWW
  FLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSND
  KEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKY
  WTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071447
• RefSeq Size: 2252
• RefSeq ORF: 1401
• Synonyms: ARG1; LCN7; LIECG3; TINAGRP
• Locus ID: 64129
• UniProt ID: Q9GZM7
• Cytogenetics: 1p35.2
• Summary: The protein encoded by this gene is similar in sequence to tubulointerstitial nephritis antigen, a secreted glycoprotein that is recognized by antibodies in some types of immune-related tubulointerstitial nephritis. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome, Protease, Secreted Protein