TINAGL1 (NM_022164) Human Recombinant Protein

CAT#: TP309508

Recombinant protein of human tubulointerstitial nephritis antigen-like 1 (TINAGL1)

Product Images

Coomassie blue staining of purified TINAGL1 protein (Cat# TP309508). The protein was produced from HEK293T cells transfected with TINAGL1 cDNA clone (Cat# RC209508) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209508 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MWRCPLGLLLLLPLAGHLALGAQQGRGRRELAPGLHLRGIRDAGGRYCQEQDLCCRGRADDCALPYLGAI
  CYCDLFCNRTVSDCCPDFWDFCLGVPPPFPPIQGCMHGGRIYPVLGTYWDNCNRCTCQENRQWQCDQEPC
  LVDPDMIKAINQGNYGWQAGNHSAFWGMTLDEGIRYRLGTIRPSSSVMNMHEIYTVLNPGEVLPTAFEAS
  EKWPNLIHEPLDQGNCAGSWAFSTAAVASDRVSIHSLGHMTPVLSPQNLLSCDTHQQQGCRGGRLDGAWW
  FLRRRGVVSDHCYPFSGRERDEAGPAPPCMMHSRAMGRGKRQATAHCPNSYVNNNDIYQVTPVYRLGSND
  KEIMKELMENGPVQALMEVHEDFFLYKGGIYSHTPVSLGRPERYRRHGTHSVKITGWGEETLPDGRTLKY
  WTAANSWGPAWGERGHFRIVRGVNECDIESFVLGVWGRVGMEDMGHH
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 52.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_071447
• Locus ID: 64129
• UniProt ID: Q9GZM7
• Cytogenetics: 1p35.2
• Refseq Size: 2252
• Refseq ORF: 1401
• Synonyms: ARG1; LCN7; LIECG3; TINAGRP
• Summary: The protein encoded by this gene is similar in sequence to tubulointerstitial nephritis antigen, a secreted glycoprotein that is recognized by antibodies in some types of immune-related tubulointerstitial nephritis. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2011]
• Protein Families: Druggable Genome, Protease, Secreted Protein