Septin 11 (SEPT11) (NM_018243) Human Mass Spec Standard

CAT#: PH309525

SEPT11 MS Standard C13 and N15-labeled recombinant protein (NP_060713)

Product Images

Coomassie blue staining of purified SEPTIN11 protein (Cat# TP309525). The protein was produced from HEK293T cells transfected with SEPTIN11 cDNA clone (Cat# RC209525) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209525
• Predicted MW: 49.4 kDa
• Protein Sequence:
  Sequence Link

  >RC209525 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAVAVGRPSNEELRNLSLSGHVGFDSLPDQLVNKSTSQGFCFNILCVGETGIGKSTLMDTLFNTKFESDP
  ATHNEPGVRLKARSYELQESNVRLKLTIVDTVGFGDQINKDDSYKPIVEYIDAQFEAYLQEELKIKRSLF
  NYHDTRIHACLYFIAPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTIAKNELHKFKSKIMSELVSNGVQ
  IYQFPTDEETVAEINATMSVHLPFAVVGSTEEVKIGNKMAKARQYPWGVVQVENENHCDFVKLREMLIRV
  NMEDLREQTHTRHYELYRRCKLEEMGFKDTDPDSKPFSLQETYEAKRNEFLGELQKKEEEMRQMFVMRVK
  EKEAELKEAEKELHEKFDLLKRTHQEEKKKVEDKKKELEEEVNNFQKKKAAAQLLQSQAQQSGAQQTKKD
  KDKKNASFT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_060713
• RefSeq Size: 5582
• RefSeq ORF: 1287
• Synonyms: SEPT11
• Locus ID: 55752
• UniProt ID: Q9NVA2, A0A384P5S0
• Cytogenetics: 4q21.1
• Summary: SEPT11 belongs to the conserved septin family of filament-forming cytoskeletal GTPases that are involved in a variety of cellular functions including cytokinesis and vesicle trafficking (Hanai et al., 2004 [PubMed 15196925]; Nagata et al., 2004 [PubMed 15485874]). [supplied by OMIM, Jul 2009]