BOLA1 (NM_016074) Human Mass Spec Standard

CAT#: PH309532

BOLA1 MS Standard C13 and N15-labeled recombinant protein (NP_057158)

Product Images

Coomassie blue staining of purified BOLA1 protein (Cat# TP309532). The protein was produced from HEK293T cells transfected with BOLA1 cDNA clone (Cat# RC209532) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209532
• Predicted MW: 14.1 kDa
• Protein Sequence:
  Sequence Link

  >RC209532 representing NM_016074
  Red=Cloning site Green=Tags(s)
  
  MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRV
  AVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057158
• RefSeq Size: 812
• RefSeq ORF: 411
• Synonyms: CGI-143
• Locus ID: 51027
• UniProt ID: Q9Y3E2
• Cytogenetics: 1q21.2
• Protein Families: Transcription Factors