BOLA1 (NM_016074) Human Recombinant Protein

CAT#: TP309532

Recombinant protein of human bolA homolog 1 (E. coli) (BOLA1)

Product Images

Coomassie blue staining of purified BOLA1 protein (Cat# TP309532). The protein was produced from HEK293T cells transfected with BOLA1 cDNA clone (Cat# RC209532) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209532 representing NM_016074
  Red=Cloning site Green=Tags(s)
  
  MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRV
  AVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057158
• Locus ID: 51027
• UniProt ID: Q9Y3E2
• Cytogenetics: 1q21.2
• Refseq Size: 812
• Refseq ORF: 411
• Synonyms: CGI-143
• Summary: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins (By similarity). Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225).[UniProtKB/Swiss-Prot Function]
• Protein Families: Transcription Factors