BOLA1 (NM_016074) Human Recombinant Protein
CAT#: TP309532
Recombinant protein of human bolA homolog 1 (E. coli) (BOLA1)
View other "BOLA1" proteins (1)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209532 representing NM_016074
Red=Cloning site Green=Tags(s) MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRV AVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_057158 |
Locus ID | 51027 |
UniProt ID | Q9Y3E2 |
Cytogenetics | 1q21.2 |
Refseq Size | 812 |
Refseq ORF | 411 |
Synonyms | CGI-143 |
Summary | Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins (By similarity). Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225).[UniProtKB/Swiss-Prot Function] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
PH309532 | BOLA1 MS Standard C13 and N15-labeled recombinant protein (NP_057158) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review