Galectin 2 (LGALS2) (NM_006498) Human Mass Spec Standard

CAT#: PH309552

LGALS2 MS Standard C13 and N15-labeled recombinant protein (NP_006489)

Product Images

Coomassie blue staining of purified LGALS2 protein (Cat# TP309552). The protein was produced from HEK293T cells transfected with LGALS2 cDNA clone (Cat# RC209552) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209552
• Predicted MW: 14.6 kDa
• Protein Sequence:
  Sequence Link

  >RC209552 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQR
  EDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006489
• RefSeq Size: 543
• RefSeq ORF: 396
• Synonyms: HL14
• Locus ID: 3957
• UniProt ID: P05162
• Cytogenetics: 22q13.1
• Summary: 'The protein encoded by this gene is a soluble beta-galactoside binding lectin. The encoded protein is found as a homodimer and can bind to lymphotoxin-alpha. A single nucleotide polymorphism in an intron of this gene can alter the transcriptional level of the protein, with a resultant increased risk of myocardial infarction. [provided by RefSeq, Jul 2008]'