Galectin 2 (LGALS2) (NM_006498) Human Recombinant Protein
CAT#: TP309552
Recombinant protein of human lectin, galactoside-binding, soluble, 2 (LGALS2)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209552 protein sequence
Red=Cloning site Green=Tags(s) MTGELEVKNMDMKPGSTLKITGSIADGTDGFVINLGQGTDKLNLHFNPRFSESTIVCNSLDGSNWGQEQR EDHLCFSPGSEVKFTVTFESDKFKVKLPDGHELTFPNRLGHSHLSYLSVRGGFNMSSFKLKE myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 14.5 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_006489 |
| Locus ID | 3957 |
| UniProt ID | P05162 |
| Cytogenetics | 22q13.1 |
| Refseq Size | 543 |
| Refseq ORF | 396 |
| Synonyms | HL14 |
| Summary | The protein encoded by this gene is a soluble beta-galactoside binding lectin. The encoded protein is found as a homodimer and can bind to lymphotoxin-alpha. A single nucleotide polymorphism in an intron of this gene can alter the transcriptional level of the protein, with a resultant increased risk of myocardial infarction. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416599 | LGALS2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY416599 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 2 (LGALS2) |
USD 436.00 |
|
| PH309552 | LGALS2 MS Standard C13 and N15-labeled recombinant protein (NP_006489) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China