Galectin 7 (LGALS7B) (NM_001042507) Human Mass Spec Standard

CAT#: PH309569

LGALS7B MS Standard C13 and N15-labeled recombinant protein (NP_001035972)

Product Images

Coomassie blue staining of purified LGALS7B protein (Cat# TP309569). The protein was produced from HEK293T cells transfected with LGALS7B cDNA clone (Cat# RC209569) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209569
• Predicted MW: 15.1 kDa
• Protein Sequence:
  Sequence Link

  >RC209569 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW
  GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001035972
• RefSeq Size: 506
• RefSeq ORF: 408
• Synonyms: Gal-7; GAL7; HKL-14; LGALS7; PI7
• Locus ID: 653499
• UniProt ID: P47929
• Cytogenetics: 19q13.2
• Summary: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:3963) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008]