Galectin 7 (LGALS7B) (NM_001042507) Human Recombinant Protein

CAT#: TP309569

Recombinant protein of human lectin, galactoside-binding, soluble, 7B (LGALS7B)

Product Images

Coomassie blue staining of purified LGALS7B protein (Cat# TP309569). The protein was produced from HEK293T cells transfected with LGALS7B cDNA clone (Cat# RC209569) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209569 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW
  GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.9 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001035972
• Locus ID: 653499
• UniProt ID: P47929
• Cytogenetics: 19q13.2
• Refseq Size: 506
• Refseq ORF: 408
• Synonyms: Gal-7; GAL7; HKL-14; LGALS7; PI7
• Summary: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:3963) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008]