Galectin 7 (LGALS7B) (NM_001042507) Human Recombinant Protein
CAT#: TP309569
Recombinant protein of human lectin, galactoside-binding, soluble, 7B (LGALS7B)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209569 protein sequence
Red=Cloning site Green=Tags(s) MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSW GREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 14.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001035972 |
Locus ID | 653499 |
UniProt ID | P47929 |
Cytogenetics | 19q13.2 |
Refseq Size | 506 |
Refseq ORF | 408 |
Synonyms | Gal-7; GAL7; HKL-14; LGALS7; PI7 |
Summary | The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Differential and in situ hybridization studies indicate that this lectin is specifically expressed in keratinocytes and found mainly in stratified squamous epithelium. A duplicate copy of this gene (GeneID:3963) is found adjacent to, but on the opposite strand on chromosome 19. [provided by RefSeq, Jul 2008] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC420948 | LGALS7B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY420948 | Transient overexpression lysate of lectin, galactoside-binding, soluble, 7B (LGALS7B) |
USD 325.00 |
|
PH309569 | LGALS7B MS Standard C13 and N15-labeled recombinant protein (NP_001035972) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review