RD3 (NM_183059) Human Mass Spec Standard

CAT#: PH309596

RD3 MS Standard C13 and N15-labeled recombinant protein (NP_898882)

Product Images

Coomassie blue staining of purified RD3 protein (Cat# TP309596). The protein was produced from HEK293T cells transfected with RD3 cDNA clone (Cat# RC209596) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209596
• Predicted MW: 22.7 kDa
• Protein Sequence:
  Sequence Link

  >RC209596 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST
  YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR
  QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_898882
• RefSeq Size: 4290
• RefSeq ORF: 585
• Synonyms: C1orf36; LCA12
• Locus ID: 343035
• UniProt ID: Q7Z3Z2
• Cytogenetics: 1q32.3
• Summary: This gene encodes a retinal protein that is associated with promyelocytic leukemia-gene product (PML) bodies in the nucleus. Mutations in this gene cause Leber congenital amaurosis type 12, a disease that results in retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]