RD3 (NM_183059) Human Recombinant Protein
CAT#: TP309596
Recombinant protein of human retinal degeneration 3 (RD3)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209596 protein sequence
Red=Cloning site Green=Tags(s) MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 22.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_898882 |
Locus ID | 343035 |
UniProt ID | Q7Z3Z2 |
Cytogenetics | 1q32.3 |
Refseq Size | 4290 |
Refseq ORF | 585 |
Synonyms | C1orf36; LCA12 |
Summary | This gene encodes a retinal protein that is associated with promyelocytic leukemia-gene product (PML) bodies in the nucleus. Mutations in this gene cause Leber congenital amaurosis type 12, a disease that results in retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009] |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC405222 | RD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431781 | RD3 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY405222 | Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 1 |
USD 396.00 |
|
LY431781 | Transient overexpression lysate of retinal degeneration 3 (RD3), transcript variant 2 |
USD 396.00 |
|
PH309596 | RD3 MS Standard C13 and N15-labeled recombinant protein (NP_898882) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review