RD3 (NM_183059) Human Recombinant Protein

CAT#: TP309596

Recombinant protein of human retinal degeneration 3 (RD3)

Product Images

Coomassie blue staining of purified RD3 protein (Cat# TP309596). The protein was produced from HEK293T cells transfected with RD3 cDNA clone (Cat# RC209596) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209596 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSLISWLRWNEAPSRLSTRSPAEMVLETLMMELTGQMREAERQQRERSNAVRKVCTGVDYSWLASTPRST
  YDLSPIERLQLEDVCVKIHPSYCGPAILRFRQLLAEQEPEVQEVSQLFRSVLQEVLERMKQEEEAHKLTR
  QWSLRPRGSLATFKTRARISPFASDIRTISEDVERDTPPPLRSWSMPEFRAPKAD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_898882
• Locus ID: 343035
• UniProt ID: Q7Z3Z2
• Cytogenetics: 1q32.3
• Refseq Size: 4290
• Refseq ORF: 585
• Synonyms: C1orf36; LCA12
• Summary: This gene encodes a retinal protein that is associated with promyelocytic leukemia-gene product (PML) bodies in the nucleus. Mutations in this gene cause Leber congenital amaurosis type 12, a disease that results in retinal degeneration. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2009]