OTUB2 (NM_023112) Human Mass Spec Standard

CAT#: PH309650

OTUB2 MS Standard C13 and N15-labeled recombinant protein (NP_075601)

Product Images

Coomassie blue staining of purified OTUB2 protein (Cat# TP309650). The protein was produced from HEK293T cells transfected with OTUB2 cDNA clone (Cat# RC209650) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209650
• Predicted MW: 27.2 kDa
• Protein Sequence:
  Sequence Link

  >RC209650 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE
  IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS
  AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE
  AATPSVYLLYKTSHYNILYAADKH
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_075601
• RefSeq Size: 3873
• RefSeq ORF: 702
• Synonyms: C14orf137; OTB2; OTU2
• Locus ID: 78990
• UniProt ID: Q96DC9
• Cytogenetics: 14q32.12
• Summary: This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. [provided by RefSeq, Aug 2011]
• Protein Families: Protease