Germany
Japan
United Kingdom
China
OTUB2 (NM_023112) Human Recombinant Protein
CAT#: TP309650
Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2)
Product Images
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC209650 protein sequence
Red=Cloning site Green=Tags(s) MSETSFNLISEKCDILSILRDHPENRIYRRKIEELSKRFTAIRKTKGDGNCFYRALGYSYLESLLGKSRE IFKFKERVLQTPNDLLAAGFEEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS AFIRNRADFFRHFIDEEMDIKDFCTHEVEPMATECDHIQITALSQALSIALQVEYVDEMDTALNHHVFPE AATPSVYLLYKTSHYNILYAADKH SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Predicted MW | 27 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_075601 |
| Locus ID | 78990 |
| UniProt ID | Q96DC9 |
| Cytogenetics | 14q32.12 |
| Refseq Size | 3873 |
| Refseq ORF | 702 |
| Synonyms | C14orf137; OTB2; OTU2 |
| Summary | This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. [provided by RefSeq, Aug 2011] |
| Protein Families | Protease |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402958 | OTUB2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
| LY402958 | Transient overexpression lysate of OTU domain, ubiquitin aldehyde binding 2 (OTUB2) |
USD 325.00 |
|
| PH309650 | OTUB2 MS Standard C13 and N15-labeled recombinant protein (NP_075601) |
USD 2,055.00 |
|
| TP720215 | Recombinant protein of human OTU domain, ubiquitin aldehyde binding 2 (OTUB2) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
