TPK1 (NM_022445) Human Mass Spec Standard

CAT#: PH309721

TPK1 MS Standard C13 and N15-labeled recombinant protein (NP_071890)

Product Images

Coomassie blue staining of purified TPK1 protein (Cat# TP309721). The protein was produced from HEK293T cells transfected with TPK1 cDNA clone (Cat# RC209721) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209721
• Predicted MW: 27.2 kDa
• Protein Sequence:
  Sequence Link

  >RC209721 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING
  DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN
  TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQVTTTGLKWNLTNDVLA
  FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_071890
• RefSeq Size: 2449
• RefSeq ORF: 729
• Synonyms: HTPK1; PP20; THMD5
• Locus ID: 27010
• UniProt ID: Q9H3S4, A0A090N8Y0
• Cytogenetics: 7q35
• Summary: The protein encoded by this gene functions as a homodimer and catalyzes the conversion of thiamine to thiamine pyrophosphate, a cofactor for some enzymes of the glycolytic and energy production pathways. Defects in this gene are a cause of thiamine metabolism dysfunction syndrome-5. [provided by RefSeq, Apr 2017]
• Protein Families: Druggable Genome
• Protein Pathways: Metabolic pathways, Thiamine metabolism