TPK1 (NM_022445) Human Recombinant Protein
CAT#: TP309721
Recombinant protein of human thiamin pyrophosphokinase 1 (TPK1), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209721 protein sequence
Red=Cloning site Green=Tags(s) MEHAFTPLEPLLSTGNLKYCLVILNQPLDNYFRHLWNKALLRACADGGANRLYDITEGERESFLPEFING DFDSIRPEVREYYATKGCELISTPDQDHTDFTKCLKMLQKKIEEKDLKVDVIVTLGGLAGRFDQIMASVN TLFQATHITPFPIIIIQEESLIYLLQPGKHRLHVDTGMEGDWCGLIPVGQPCSQVTTTGLKWNLTNDVLA FGTLVSTSNTYDGSGVVTVETDHPLLWTMAIKS myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 27.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_071890 |
Locus ID | 27010 |
UniProt ID | Q9H3S4, A0A090N8Y0 |
Cytogenetics | 7q35 |
Refseq Size | 2449 |
Refseq ORF | 729 |
Synonyms | HTPK1; PP20; THMD5 |
Summary | The protein encoded by this gene functions as a homodimer and catalyzes the conversion of thiamine to thiamine pyrophosphate, a cofactor for some enzymes of the glycolytic and energy production pathways. Defects in this gene are a cause of thiamine metabolism dysfunction syndrome-5. [provided by RefSeq, Apr 2017] |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Thiamine metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411708 | TPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC420935 | TPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425757 | TPK1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY411708 | Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 1 |
USD 325.00 |
|
LY420935 | Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 2 |
USD 325.00 |
|
LY425757 | Transient overexpression lysate of thiamin pyrophosphokinase 1 (TPK1), transcript variant 2 |
USD 325.00 |
|
PH309721 | TPK1 MS Standard C13 and N15-labeled recombinant protein (NP_071890) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review