RAB26 (NM_014353) Human Mass Spec Standard

CAT#: PH309740

RAB26 MS Standard C13 and N15-labeled recombinant protein (NP_055168)

Product Images

Coomassie blue staining of purified RAB26 protein (Cat# TP309740). The protein was produced from HEK293T cells transfected with RAB26 cDNA clone (Cat# RC209740) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209740
• Predicted MW: 27.9 kDa
• Protein Sequence:
  Sequence Link

  >RC209740 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFKVMLVG
  DSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRSVTHAYYRDAHAL
  LLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKT
  GLNVDLAFTAIAKELKRRSMKAPSEPRFRLHDYVKREGRGASCCRP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055168
• RefSeq Size: 1641
• RefSeq ORF: 768
• Synonyms: V46133
• Locus ID: 25837
• UniProt ID: Q9ULW5
• Cytogenetics: 16p13.3
• Summary: Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by Seki et al., 2000 [PubMed 11043516]). [supplied by OMIM, Nov 2010]
• Protein Families: Druggable Genome