RAB26 (NM_014353) Human Recombinant Protein

CAT#: TP309740

Recombinant protein of human RAB26, member RAS oncogene family (RAB26)

Product Images

Coomassie blue staining of purified RAB26 protein (Cat# TP309740). The protein was produced from HEK293T cells transfected with RAB26 cDNA clone (Cat# RC209740) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209740 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSRKKTPKSKGASTPAASTLPTANGARPARSGTALSGPDAPPNGPLQPGRPSLGGGVDFYDVAFKVMLVG
  DSGVGKTCLLVRFKDGAFLAGTFISTVGIDFRNKVLDVDGVKVKLQMWDTAGQERFRSVTHAYYRDAHAL
  LLLYDVTNKASFDNIQAWLTEIHEYAQHDVALMLLGNKVDSAHERVVKREDGEKLAKEYGLPFMETSAKT
  GLNVDLAFTAIAKELKRRSMKAPSEPRFRLHDYVKREGRGASCCRP
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 27.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055168
• Locus ID: 25837
• UniProt ID: Q9ULW5
• Cytogenetics: 16p13.3
• Refseq Size: 1641
• Refseq ORF: 768
• Synonyms: V46133
• Summary: Members of the RAB protein family, including RAB26, are important regulators of vesicular fusion and trafficking. The RAB family of small G proteins regulates intercellular vesicle trafficking, including exocytosis, endocytosis, and recycling (summary by Seki et al., 2000 [PubMed 11043516]).[supplied by OMIM, Nov 2010]
• Protein Families: Druggable Genome