Activator of basal transcription 1 (ABT1) (NM_013375) Human Mass Spec Standard

CAT#: PH309762

ABT1 MS Standard C13 and N15-labeled recombinant protein (NP_037507)

Product Images

Coomassie blue staining of purified ABT1 protein (Cat# TP309762). The protein was produced from HEK293T cells transfected with ABT1 cDNA clone (Cat# RC209762) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209762
• Predicted MW: 31.1 kDa
• Protein Sequence:
  Sequence Link

  >RC209762 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYG
  EVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRVAASLHNTPMGARRRSPFRY
  DLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWT
  FAQRPTEQELRARKAARPGGRERARLATAQDKARSNKGLLARIFGAPPPSESMEGPSLVRDS
  
  SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_037507
• RefSeq Size: 2264
• RefSeq ORF: 816
• Synonyms: Esf2; hABT1
• Locus ID: 29777
• UniProt ID: Q9ULW3, A0A024R029
• Cytogenetics: 6p22.2
• Summary: Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by this gene likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA. [provided by RefSeq, Jul 2008]
• Protein Families: Transcription Factors