Activator of basal transcription 1 (ABT1) (NM_013375) Human Recombinant Protein
CAT#: TP309762
Recombinant protein of human activator of basal transcription 1 (ABT1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209762 protein sequence
Red=Cloning site Green=Tags(s) MEAEESEKAATEQEPLEGTEQTLDAEEEQEESEEAACGSKKRVVPGIVYLGHIPPRFRPLHVRNLLSAYG EVGRVFFQAEDRFVRRKKKAAAAAGGKKRSYTKDYTEGWVEFRDKRIAKRVAASLHNTPMGARRRSPFRY DLWNLKYLHRFTWSHLSEHLAFERQVRRQRLRAEVAQAKRETDFYLQSVERGQRFLAADGDPARPDGSWT FAQRPTEQELRARKAARPGGRERARLATAQDKARSNKGLLARIFGAPPPSESMEGPSLVRDS SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Predicted MW | 30.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_037507 |
Locus ID | 29777 |
UniProt ID | Q9ULW3, A0A024R029 |
Cytogenetics | 6p22.2 |
Refseq Size | 2264 |
Refseq ORF | 816 |
Synonyms | Esf2; hABT1 |
Summary | Basal transcription of genes by RNA polymerase II requires the interaction of TATA-binding protein (TBP) with the core region of class II promoters. Studies in mouse suggest that the protein encoded by this gene likely activates basal transcription from class II promoters by interaction with TBP and the class II promoter DNA. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC415635 | ABT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY415635 | Transient overexpression lysate of activator of basal transcription 1 (ABT1) |
USD 325.00 |
|
PH309762 | ABT1 MS Standard C13 and N15-labeled recombinant protein (NP_037507) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review