TIMP2 (NM_003255) Human Mass Spec Standard

CAT#: PH309796

TIMP2 MS Standard C13 and N15-labeled recombinant protein (NP_003246)

Product Images

Coomassie blue staining of purified TIMP2 protein (Cat# TP309796). The protein was produced from HEK293T cells transfected with TIMP2 cDNA clone (Cat# RC209796) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209796
• Predicted MW: 24.4 kDa
• Protein Sequence:
  Sequence Link

  >RC209796 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGAAARTLRLALGLLLLATLLRPADACSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQ
  YEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQ
  KKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPP
  KQEFLDIEDP
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003246
• RefSeq Size: 3670
• RefSeq ORF: 660
• Synonyms: CSC-21K; DDC8
• Locus ID: 7077
• UniProt ID: P16035, A0A140VK57
• Cytogenetics: 17q25.3
• Summary: 'This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome, Secreted Protein