TIMP2 (NM_003255) Human Recombinant Protein
CAT#: TP720667
Purified recombinant protein of Human TIMP metallopeptidase inhibitor 2 (TIMP2)
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDPVDHHHHHH
|
Tag | C-His |
Predicted MW | 22.79 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_003246 |
Locus ID | 7077 |
UniProt ID | P16035, A0A140VK57 |
Cytogenetics | 17q25.3 |
Refseq Size | 3670 |
Refseq ORF | 660 |
Synonyms | CSC-21K; DDC8 |
Summary | 'This gene is a member of the TIMP gene family. The proteins encoded by this gene family are natural inhibitors of the matrix metalloproteinases, a group of peptidases involved in degradation of the extracellular matrix. In addition to an inhibitory role against metalloproteinases, the encoded protein has a unique role among TIMP family members in its ability to directly suppress the proliferation of endothelial cells. As a result, the encoded protein may be critical to the maintenance of tissue homeostasis by suppressing the proliferation of quiescent tissues in response to angiogenic factors, and by inhibiting protease activity in tissues undergoing remodelling of the extracellular matrix. [provided by RefSeq, Jul 2008]' |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418809 | TIMP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418809 | Transient overexpression lysate of TIMP metallopeptidase inhibitor 2 (TIMP2) |
USD 325.00 |
|
PH309796 | TIMP2 MS Standard C13 and N15-labeled recombinant protein (NP_003246) |
USD 2,055.00 |
|
TP309796 | Recombinant protein of human TIMP metallopeptidase inhibitor 2 (TIMP2) |
USD 823.00 |
|
TP723448 | Purified recombinant protein of Human TIMP metallopeptidase inhibitor 2 (TIMP2). |
USD 240.00 |
|
TP723886 | Purified recombinant protein of Human TIMP metallopeptidase inhibitor 2 (TIMP2) |
USD 270.00 |
{0} Product Review(s)
Be the first one to submit a review