YB1 (YBX1) (NM_004559) Human Mass Spec Standard

CAT#: PH309835

YBX1 MS Standard C13 and N15-labeled recombinant protein (NP_004550)

Product Images

Coomassie blue staining of purified YBX1 protein (Cat# TP309835). The protein was produced from HEK293T cells transfected with YBX1 cDNA clone (Cat# RC209835) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209835
• Predicted MW: 35.9 kDa
• Protein Sequence:
  Sequence Link

  >RC209835 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSEAETQQPPAAPPAAPALSAADTKPGTTGSGAGSGGPGGLTSAAPAGGDKKVIATKVLGTVKWFNVRN
  GYGFINRNDTKEDVFVHQTAIKKNNPRKYLRSVGDGETVEFDVVEGEKGAEAANVTGPGGVPVQGSKYAA
  DRNHYRRYPRRRGPPRNYQQNYQNSESGEKNEGSESAPEGQAQQRRPYRRRRFPPYYMRRPYGRRPQYSN
  PPVQGEVMEGADNQGAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRR
  YRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004550
• RefSeq Size: 1561
• RefSeq ORF: 972
• Synonyms: BP-8; CBF-A; CSDA2; CSDB; DBPB; EFI-A; MDR-NF1; NSEP-1; NSEP1; YB-1; YB1
• Locus ID: 4904
• UniProt ID: P67809
• Cytogenetics: 1p34.2
• Summary: 'This gene encodes a highly conserved cold shock domain protein that has broad nucleic acid binding properties. The encoded protein functions as both a DNA and RNA binding protein and has been implicated in numerous cellular processes including regulation of transcription and translation, pre-mRNA splicing, DNA reparation and mRNA packaging. This protein is also a component of messenger ribonucleoprotein (mRNP) complexes and may have a role in microRNA processing. This protein can be secreted through non-classical pathways and functions as an extracellular mitogen. Aberrant expression of the gene is associated with cancer proliferation in numerous tissues. This gene may be a prognostic marker for poor outcome and drug resistance in certain cancers. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on multiple chromosomes. [provided by RefSeq, Sep 2015]'
• Protein Families: ES Cell Differentiation/IPS, Transcription Factors