RHOB (NM_004040) Human Mass Spec Standard

CAT#: PH309837

RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031)

Product Images

Coomassie blue staining of purified RHOB protein (Cat# TP309837). The protein was produced from HEK293T cells transfected with RHOB cDNA clone (Cat# RC209837) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209837
• Predicted MW: 22.1 kDa
• Protein Sequence:
  Sequence Link

  >RC209837 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR
  PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR
  TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004031
• RefSeq Size: 2384
• RefSeq ORF: 588
• Synonyms: ARH6; ARHB; MST081; MSTP081; RHOH6
• Locus ID: 388
• UniProt ID: P62745
• Cytogenetics: 2p24.1
• Summary: ''
• Protein Families: Druggable Genome