RHOB (NM_004040) Human Recombinant Protein
CAT#: TP309837
Recombinant protein of human ras homolog gene family, member B (RHOB)
View other "RHOB" proteins (4)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209837 protein sequence
Red=Cloning site Green=Tags(s) MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLR PLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVR TDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21.9 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_004031 |
Locus ID | 388 |
UniProt ID | P62745 |
Cytogenetics | 2p24.1 |
Refseq Size | 2384 |
Refseq ORF | 588 |
Synonyms | ARH6; ARHB; MST081; MSTP081; RHOH6 |
Summary | Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418297 | RHOB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418297 | Transient overexpression lysate of ras homolog gene family, member B (RHOB) |
USD 396.00 |
|
PH309837 | RHOB MS Standard C13 and N15-labeled recombinant protein (NP_004031) |
USD 2,055.00 |
|
TP701009 | Purified recombinant protein of Human ras homolog gene family, member B (RHOB), mutant (S73F), expressed in HEK293 cells, 20ug |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review