Ferritin Heavy Chain (FTH1) (NM_002032) Human Mass Spec Standard
CAT#: PH309845
FTH1 MS Standard C13 and N15-labeled recombinant protein (NP_002023)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC209845 |
| Predicted MW | 21.2 kDa |
| Protein Sequence |
>RC209845 protein sequence
Red=Cloning site Green=Tags(s) MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_002023 |
| RefSeq Size | 1245 |
| RefSeq ORF | 549 |
| Synonyms | FHC; FTH; FTHL6; HFE5; PIG15; PLIF |
| Locus ID | 2495 |
| UniProt ID | P02794, A0A024R525 |
| Cytogenetics | 11q12.3 |
| Summary | 'This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]' |
| Protein Families | Druggable Genome |
| Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400741 | FTH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400741 | Transient overexpression lysate of ferritin, heavy polypeptide 1 (FTH1) |
USD 436.00 |
|
| TP309845 | Recombinant protein of human ferritin, heavy polypeptide 1 (FTH1) |
USD 823.00 |
|
| TP721180 | Purified recombinant protein of Human ferritin, heavy polypeptide 1 (FTH1) |
USD 330.00 |
|
| TP721183 | Purified recombinant protein of Human ferritin, heavy polypeptide 1 (FTH1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China