Ferritin Heavy Chain (FTH1) (NM_002032) Human Recombinant Protein

CAT#: TP309845

Recombinant protein of human ferritin, heavy polypeptide 1 (FTH1)

Product Images

Coomassie blue staining of purified FTH1 protein (Cat# TP309845). The protein was produced from HEK293T cells transfected with FTH1 cDNA clone (Cat# RC209845) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209845 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL
  MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN
  EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 21 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002023
• Locus ID: 2495
• UniProt ID: P02794, A0A024R525
• Cytogenetics: 11q12.3
• Refseq Size: 1245
• Refseq ORF: 549
• Synonyms: FHC; FTH; FTHL6; HFE5; PIG15; PLIF
• Summary: This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome
• Protein Pathways: Porphyrin and chlorophyll metabolism