Ferritin Heavy Chain (FTH1) (NM_002032) Human Recombinant Protein
CAT#: TP309845
Recombinant protein of human ferritin, heavy polypeptide 1 (FTH1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC209845 protein sequence
Red=Cloning site Green=Tags(s) MTTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSHEEREHAEKL MKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKLATDKNDPHLCDFIETHYLN EQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDNES myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 21 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_002023 |
Locus ID | 2495 |
UniProt ID | P02794, A0A024R525 |
Cytogenetics | 11q12.3 |
Refseq Size | 1245 |
Refseq ORF | 549 |
Synonyms | FHC; FTH; FTHL6; HFE5; PIG15; PLIF |
Summary | This gene encodes the heavy subunit of ferritin, the major intracellular iron storage protein in prokaryotes and eukaryotes. It is composed of 24 subunits of the heavy and light ferritin chains. Variation in ferritin subunit composition may affect the rates of iron uptake and release in different tissues. A major function of ferritin is the storage of iron in a soluble and nontoxic state. Defects in ferritin proteins are associated with several neurodegenerative diseases. This gene has multiple pseudogenes. Several alternatively spliced transcript variants have been observed, but their biological validity has not been determined. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | Porphyrin and chlorophyll metabolism |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400741 | FTH1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY400741 | Transient overexpression lysate of ferritin, heavy polypeptide 1 (FTH1) |
USD 325.00 |
|
PH309845 | FTH1 MS Standard C13 and N15-labeled recombinant protein (NP_002023) |
USD 2,055.00 |
|
TP721180 | Purified recombinant protein of Human ferritin, heavy polypeptide 1 (FTH1) |
USD 300.00 |
|
TP721183 | Purified recombinant protein of Human ferritin, heavy polypeptide 1 (FTH1) |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review