POLD4 (NM_021173) Human Mass Spec Standard

CAT#: PH309992

POLD4 MS Standard C13 and N15-labeled recombinant protein (NP_066996)

Product Images

Coomassie blue staining of purified POLD4 protein (Cat# TP309992). The protein was produced from HEK293T cells transfected with POLD4 cDNA clone (Cat# RC209992) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC209992
• Predicted MW: 12.4 kDa
• Protein Sequence:
  Sequence Link

  >RC209992 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRW
  CRAKHMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066996
• RefSeq Size: 1751
• RefSeq ORF: 321
• Synonyms: p12; POLDS
• Locus ID: 57804
• UniProt ID: Q9HCU8, A0A024R5D7, Q6NSD7
• Cytogenetics: 11q13.2
• Summary: This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]
• Protein Pathways: Base excision repair, DNA replication, Homologous recombination, Metabolic pathways, Mismatch repair, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism