POLD4 (NM_021173) Human Recombinant Protein

CAT#: TP309992

Recombinant protein of human polymerase (DNA-directed), delta 4 (POLD4)

Product Images

Coomassie blue staining of purified POLD4 protein (Cat# TP309992). The protein was produced from HEK293T cells transfected with POLD4 cDNA clone (Cat# RC209992) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC209992 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPRDEEEAELELLRQFDLAWQYGPCTGITRLQRW
  CRAKHMGLEPPPEVWQVLKTHPGDPRFQCSLWHLYPL
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 12.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_066996
• Locus ID: 57804
• UniProt ID: Q9HCU8, A0A024R5D7, Q6NSD7
• Cytogenetics: 11q13.2
• Refseq Size: 1751
• Refseq ORF: 321
• Synonyms: p12; POLDS
• Summary: This gene encodes the smallest subunit of DNA polymerase delta. DNA polymerase delta possesses both polymerase and 3' to 5' exonuclease activity and plays a critical role in DNA replication and repair. The encoded protein enhances the activity of DNA polymerase delta and plays a role in fork repair and stabilization through interactions with the DNA helicase Bloom syndrome protein. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, Mar 2012]
• Protein Pathways: Base excision repair, DNA replication, Homologous recombination, Metabolic pathways, Mismatch repair, Nucleotide excision repair, Purine metabolism, Pyrimidine metabolism