PCBP2 (NM_005016) Human Mass Spec Standard
CAT#: PH310035
PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_005007)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC210035 |
| Predicted MW | 38.7 kDa |
| Protein Sequence |
>RC210035 protein sequence
Red=Cloning site Green=Tags(s) MDTGVIEGGLNVTLTIRLLMHGKEVGSIIGKKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFK AFAMIIDKLEEDISSSMTNSTAASRPPVTLRLVVPASQCGSLIGKGGCKIKEIRESTGAQVQVAGDMLPN STERAITIAGIPQSIIECVKQICVVMLETLSQSPPKGVTIPYRPKPSSSPVIFAGGQDRYSTGSDSASFP HTTPSMCLNPDLEGPPLEAYTIQGQYAIPQPDLTKLHQLAMQQSHFPMTHGNTGFSGIESSSPEVKGYWA GLDASAQTTSHELTIPNDLIGCIIGRQGAKINEIRQMSGAQIKIANPVEGSTDRQVTITGSAASISLAQY LINVRLSSETGGMGSS myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_005007 |
| RefSeq Size | 3187 |
| RefSeq ORF | 1098 |
| Synonyms | hnRNP-E2; HNRNPE2; HNRPE2 |
| Locus ID | 5094 |
| UniProt ID | Q15366, A0A384N6B9 |
| Cytogenetics | 12q13.13 |
| Summary | 'The protein encoded by this gene appears to be multifunctional. Along with PCBP-1 and hnRNPK, it is one of the major cellular poly(rC)-binding proteins. The encoded protein contains three K-homologous (KH) domains which may be involved in RNA binding. Together with PCBP-1, this protein also functions as a translational coactivator of poliovirus RNA via a sequence-specific interaction with stem-loop IV of the IRES, promoting poliovirus RNA replication by binding to its 5'-terminal cloverleaf structure. It has also been implicated in translational control of the 15-lipoxygenase mRNA, human papillomavirus type 16 L2 mRNA, and hepatitis A virus RNA. The encoded protein is also suggested to play a part in formation of a sequence-specific alpha-globin mRNP complex which is associated with alpha-globin mRNA stability. This multiexon structural mRNA is thought to be retrotransposed to generate PCBP-1, an intronless gene with functions similar to that of PCBP2. This gene and PCBP-1 have paralogous genes (PCBP3 and PCBP4) which are thought to have arisen as a result of duplication events of entire genes. This gene also has two processed pseudogenes (PCBP2P1 and PCBP2P2). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2018]' |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403134 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC417574 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC420644 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC426031 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427015 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC427016 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429233 | PCBP2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403134 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 2 |
USD 436.00 |
|
| LY417574 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 |
USD 436.00 |
|
| LY420644 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 3 |
USD 436.00 |
|
| LY426031 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 3 |
USD 396.00 |
|
| LY427015 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 6 |
USD 436.00 |
|
| LY427016 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 7 |
USD 436.00 |
|
| LY429233 | Transient overexpression lysate of poly(rC) binding protein 2 (PCBP2), transcript variant 1 |
USD 396.00 |
|
| PH300339 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_114366) |
USD 2,055.00 |
|
| PH313289 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001092090) |
USD 2,055.00 |
|
| PH325457 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122386) |
USD 2,055.00 |
|
| PH325491 | PCBP2 MS Standard C13 and N15-labeled recombinant protein (NP_001122385) |
USD 2,055.00 |
|
| TP300339 | Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 2 |
USD 823.00 |
|
| TP310035 | Recombinant protein of human poly(rC) binding protein 2 (PCBP2), transcript variant 1 |
USD 823.00 |
|
| TP313289 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 3 |
USD 748.00 |
|
| TP325457 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 7 |
USD 748.00 |
|
| TP325491 | Purified recombinant protein of Homo sapiens poly(rC) binding protein 2 (PCBP2), transcript variant 6 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China