PPM1F (NM_014634) Human Mass Spec Standard

CAT#: PH310043

PPM1F MS Standard C13 and N15-labeled recombinant protein (NP_055449)

Product Images

Coomassie blue staining of purified PPM1F protein (Cat# TP310043). The protein was produced from HEK293T cells transfected with PPM1F cDNA clone (Cat# RC210043) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210043
• Predicted MW: 49.7 kDa
• Protein Sequence:
  Sequence Link

  >RC210043 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSSGAPQKSSPMASGAEETPGFLDTLLQDFPALLNPEDPLPWKAPGTVLSQEEVEGELAELAMGFLGSRK
  APPPLAAALAHEAVSQLLQTDLSEFRKLPREEEEEEEDDDEEKAPVTLLDAQSLAQSFFNRLWEVAGQWQ
  KQVPLAARASQRQWLVSIHAIRNTRRKMEDRHVSLPSFNQLFGLSDPVNRAYFAVFDGHGGVDAARYAAV
  HVHTNAARQPELPTDPEGALREAFRRTDQMFLRKAKRERLQSGTTGVCALIAGATLHVAWLGDSQVILVQ
  QGQVVKLMEPHRPERQDEKARIEALGGFVSHMDCWRVNGTLAVSRAIGDVFQKPYVSGEADAASRALTGS
  EDYLLLACDGFFDVVPHQEVVGLVQSHLTRQQGSGLRVAEELVAAARERGSHDNITVMVVFLRDPQELLE
  GGNQGEGDPQAEGRRQDLPSSLPEPETQAPPRS
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055449
• RefSeq Size: 5199
• RefSeq ORF: 3534
• Synonyms: CAMKP; CaMKPase; FEM-2; hFEM-2; POPX2
• Locus ID: 9647
• UniProt ID: P49593
• Cytogenetics: 22q11.22
• Summary: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways. This phosphatase can interact with Rho guanine nucleotide exchange factors (PIX), and thus block the effects of p21-activated kinase 1 (PAK), a protein kinase mediating biological effects downstream of Rho GTPases. Calcium/calmodulin-dependent protein kinase II gamma (CAMK2G/CAMK-II) is found to be one of the substrates of this phosphatase. The overexpression of this phosphatase or CAMK2G has been shown to mediate caspase-dependent apoptosis. An alternatively spliced transcript variant has been identified, but its full-length nature has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Phosphatase