EIF4EBP3 (NM_003732) Human Mass Spec Standard

CAT#: PH310053

EIF4EBP3 MS Standard C13 and N15-labeled recombinant protein (NP_003723)

Product Images

Coomassie blue staining of purified EIF4EBP3 protein (Cat# TP310053). The protein was produced from HEK293T cells transfected with EIF4EBP3 cDNA clone (Cat# RC210053) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210053
• Predicted MW: 10.9 kDa
• Protein Sequence:
  Sequence Link

  >RC210053 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTP
  PTAPLSKLEELKEQETEEEIPDDAQFEMDI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003723
• RefSeq Size: 728
• RefSeq ORF: 300
• Synonyms: 4E-BP3; 4EBP3
• Locus ID: 8637
• UniProt ID: O60516
• Cytogenetics: 5q31.3
• Summary: This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq, Oct 2010]