EIF4EBP3 (NM_003732) Human Recombinant Protein

CAT#: TP310053

Recombinant protein of human eukaryotic translation initiation factor 4E binding protein 3 (EIF4EBP3)

Product Images

Coomassie blue staining of purified EIF4EBP3 protein (Cat# TP310053). The protein was produced from HEK293T cells transfected with EIF4EBP3 cDNA clone (Cat# RC210053) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210053 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSTSTSCPIPGGRDQLPDCYSTTPGGTLYATTPGGTRIIYDRKFLLECKNSPIARTPPCCLPQIPGVTTP
  PTAPLSKLEELKEQETEEEIPDDAQFEMDI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003723
• Locus ID: 8637
• UniProt ID: O60516
• Cytogenetics: 5q31.3
• Refseq Size: 728
• Refseq ORF: 300
• Synonyms: 4E-BP3; 4EBP3
• Summary: This gene encodes a member of the EIF4EBP family, which consists of proteins that bind to eukaryotic translation initiation factor 4E and regulate its assembly into EIF4F, the multi-subunit translation initiation factor that recognizes the mRNA cap structure. Read-through transcription from the neighboring upstream gene (MASK or ANKHD1) generates a transcript (MASK-BP3) that encodes a protein comprised of the MASK protein sequence for the majority of the protein and a different C-terminus due to an alternate reading frame for the EIF4EBP3 segments. [provided by RefSeq, Oct 2010]