TSC22D3 (NM_004089) Human Mass Spec Standard

CAT#: PH310088

TSC22D3 MS Standard C13 and N15-labeled recombinant protein (NP_004080)

Product Images

Coomassie blue staining of purified TSC22D3 protein (Cat# TP310088). The protein was produced from HEK293T cells transfected with TSC22D3 cDNA clone (Cat# RC210088) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210088
• Predicted MW: 14.8 kDa
• Protein Sequence:
  Sequence Link

  >RC210088 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR
  EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004080
• RefSeq Size: 1986
• RefSeq ORF: 402
• Synonyms: DIP; DSIPI; GILZ; TSC-22R
• Locus ID: 1831
• UniProt ID: Q99576
• Cytogenetics: Xq22.3
• Summary: 'This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid. This protein has also been shown to inhibit pro-inflammatory molecules including nuclear factor κB. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]'
• Protein Families: Transcription Factors