TSC22D3 (NM_004089) Human Recombinant Protein

CAT#: TP310088

Recombinant protein of human TSC22 domain family, member 3 (TSC22D3), transcript variant 2

Product Images

Coomassie blue staining of purified TSC22D3 protein (Cat# TP310088). The protein was produced from HEK293T cells transfected with TSC22D3 cDNA clone (Cat# RC210088) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210088 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNTEMYQTPMEVAVYQLHNFSISFFSSLLGGDVVSVKLDNSASGASVVAIDNKIEQAMDLVKNHLMYAVR
  EEVEILKEQIRELVEKNSQLERENTLLKTLASPEQLEKFQSCLSPEEPAPESPQVPEAPGGSAV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 14.6 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_004080
• Locus ID: 1831
• UniProt ID: Q99576
• Cytogenetics: Xq22.3
• Refseq Size: 1986
• Refseq ORF: 402
• Synonyms: DIP; DSIPI; GILZ; TSC-22R
• Summary: This gene encodes the anti-inflammatory protein glucocorticoid (GC)-induced leucine zipper. Expression of this gene stimulated by glucocorticoids and interleukin 10 and it appears to play a key role in the anti-inflammatory and immunosuppressive effects of this steroid. This protein has also been shown to inhibit pro-inflammatory molecules including nuclear factor κB. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]
• Protein Families: Transcription Factors