RELM beta (RETNLB) (NM_032579) Human Mass Spec Standard
CAT#: PH310104
RETNLB MS Standard C13 and N15-labeled recombinant protein (NP_115968)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC210104 |
Predicted MW | 11.7 kDa |
Protein Sequence |
>RC210104 protein sequence
Red=Cloning site Green=Tags(s) MGPSSCLLLILIPLLQLINPGSTQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAG MAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115968 |
RefSeq Size | 594 |
RefSeq ORF | 333 |
Synonyms | FIZZ1; FIZZ2; HXCP2; RELM-beta; RELMb; RELMbeta; XCP2 |
Locus ID | 84666 |
UniProt ID | Q9BQ08 |
Cytogenetics | 3q13.13 |
Summary | Probable hormone. [UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410034 | RETNLB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410034 | Transient overexpression lysate of resistin like beta (RETNLB) |
USD 396.00 |
|
TP310104 | Recombinant protein of human resistin like beta (RETNLB) |
USD 823.00 |
|
TP723379 | Purified recombinant protein of Human resistin like beta (RETNLB). |
USD 240.00 |
{0} Product Review(s)
Be the first one to submit a review