RELM beta (RETNLB) (NM_032579) Human Recombinant Protein

CAT#: TP723379

Purified recombinant protein of Human resistin like beta (RETNLB).


  View other "RETNLB" proteins (4)

USD 240.00

5 Days*

Size
    • 25 ug

Product Images

Other products for "RETNLB"

Specifications

Product Data
Species Human
Expression Host E. coli
Expression cDNA Clone or AA Sequence
MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
Tag Tag Free
Predicted MW 19 kDa
Concentration Resuspend the protein in the desired concentration in proper buffer
Purity >95% as determined by SDS-PAGE and Coomassie blue staining
Buffer Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Endotoxin Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Storage Store at -80°C.
Stability Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Reference Data
RefSeq NP_115968
Locus ID 84666
UniProt ID Q9BQ08
Cytogenetics 3q13.13
Refseq Size 594
Refseq ORF 333
Synonyms FIZZ1; FIZZ2; HXCP2; RELM-beta; RELMb; RELMbeta; XCP2
Summary Probable hormone. [UniProtKB/Swiss-Prot Function]
Protein Families Secreted Protein

Documents

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.