RELM beta (RETNLB) (NM_032579) Human Recombinant Protein
CAT#: TP723379
Purified recombinant protein of Human resistin like beta (RETNLB).
Product Images
![](https://cdn.origene.com/img/defaults-img.jpg)
Specifications
Product Data | |
Species | Human |
Expression Host | E. coli |
Expression cDNA Clone or AA Sequence |
MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
|
Tag | Tag Free |
Predicted MW | 19 kDa |
Concentration | Resuspend the protein in the desired concentration in proper buffer |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_115968 |
Locus ID | 84666 |
UniProt ID | Q9BQ08 |
Cytogenetics | 3q13.13 |
Refseq Size | 594 |
Refseq ORF | 333 |
Synonyms | FIZZ1; FIZZ2; HXCP2; RELM-beta; RELMb; RELMbeta; XCP2 |
Summary | Probable hormone. [UniProtKB/Swiss-Prot Function] |
Protein Families | Secreted Protein |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC410034 | RETNLB HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY410034 | Transient overexpression lysate of resistin like beta (RETNLB) |
USD 396.00 |
|
PH310104 | RETNLB MS Standard C13 and N15-labeled recombinant protein (NP_115968) |
USD 2,055.00 |
|
TP310104 | Recombinant protein of human resistin like beta (RETNLB) |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review