RELM beta (RETNLB) (NM_032579) Human Recombinant Protein

CAT#: TP723379

Purified recombinant protein of Human resistin like beta (RETNLB).

Specifications

Product Data

• Species: Human
• Expression Host: E. coli
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  MQCSLDSVMDKKIKDVLNSLEYSPSPISKKLSCASVKSQGRPSSCPAGMAVTGCACGYGCGSWDVQLETTCHCQCSVVDWTTARCCHLT
• Tag: Tag Free
• Predicted MW: 19 kDa
• Concentration: Resuspend the protein in the desired concentration in proper buffer
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Storage: Store at -80°C.
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.

Reference Data

• RefSeq: NP_115968
• Locus ID: 84666
• UniProt ID: Q9BQ08
• Cytogenetics: 3q13.13
• Refseq Size: 594
• Refseq ORF: 333
• Synonyms: FIZZ1; FIZZ2; HXCP2; RELM-beta; RELMb; RELMbeta; XCP2
• Summary: Probable hormone. [UniProtKB/Swiss-Prot Function]
• Protein Families: Secreted Protein