OBP2A (NM_014582) Human Mass Spec Standard

CAT#: PH310114

OBP2A MS Standard C13 and N15-labeled recombinant protein (NP_055397)

Product Images

Coomassie blue staining of purified OBP2A protein (Cat# TP310114). The protein was produced from HEK293T cells transfected with OBP2A cDNA clone (Cat# RC210114) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210114
• Predicted MW: 19.32 kDa
• Protein Sequence:
  Sequence Link

  >RC210114 representing NM_014582
  Red=Cloning site Green=Tags(s)
  
  MKTLFLGVTLGLAAALSFTLEEEDITGTWYVKAMVVDKDFPEDRRPRKVSPVKVTALGGGNLEATFTFMR
  EDRCIQKKILMRKTEEPGKFSAYGGRKLIYLQELPGTDDYVFYCKDQRRGGLRYMGKLVGRNPNTNLEAL
  EEFKKLVQHKGLSEEDIFMPLQTGSCVLEH
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055397
• RefSeq Size: 689
• RefSeq ORF: 510
• Synonyms: hOBPIIa; LCN13; OBP; OBP2C; OBPIIa
• Locus ID: 29991
• UniProt ID: Q9NY56
• Cytogenetics: 9q34.3
• Summary: This gene encodes a small extracellular protein belonging to the lipocalin superfamily. The protein is thought to transport small, hydrophobic, volatile molecules or odorants through the nasal mucus to olfactory receptors, and may also function as a scavenger of highly concentrated or toxic odors. The protein is expressed as a monomer in the nasal mucus, and can bind diverse types of odorants with a higher affinity for aldehydes and fatty acids. This gene and a highly similar family member are located in a cluster of lipocalin genes on chromosome 9. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]
• Protein Families: Secreted Protein