KCNJ5 (NM_000890) Human Mass Spec Standard

CAT#: PH310184

KCNJ5 MS Standard C13 and N15-labeled recombinant protein (NP_000881)

Product Images

Coomassie blue staining of purified KCNJ5 protein (Cat# TP310184). The protein was produced from HEK293T cells transfected with KCNJ5 cDNA clone (Cat# RC210184) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210184
• Predicted MW: 47.5 kDa
• Protein Sequence:
  Sequence Link

  >RC210184 representing NM_000890
  Red=Cloning site Green=Tags(s)
  
  MAGDSRNAMNQDMEIGVTPWDPKKIPKQARDYVPIATDRTRLLAEGKKPRQRYMEKSGKCNVHHGNVQET
  YRYLSDLFTTLVDLKWRFNLLVFTMVYTVTWLFFGFIWWLIAYIRGDLDHVGDQEWIPCVENLSGFVSAF
  LFSIETETTIGYGFRVITEKCPEGIILLLVQAILGSIVNAFMVGCMFVKISQPKKRAETLMFSNNAVISM
  RDEKLCLMFRVGDLRNSHIVEASIRAKLIKSRQTKEGEFIPLNQTDINVGFDTGDDRLFLVSPLIISHEI
  NEKSPFWEMSQAQLHQEEFEVVVILEGMVEATGMTCQARSSYMDTEVLWGHRFTPVLTLEKGFYEVDYNT
  FHDTYETNTPSCCAKELAEMKREGRLLQYLPSPPLLGGCAEAGLDAEAEQNEEDEPKGLGGSREARGSV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_000881
• RefSeq Size: 2912
• RefSeq ORF: 1257
• Synonyms: CIR; GIRK4; KATP1; KIR3.4; LQT13
• Locus ID: 3762
• UniProt ID: P48544, A0A5J6E2W8
• Cytogenetics: 11q24.3
• Summary: 'This gene encodes an integral membrane protein which belongs to one of seven subfamilies of inward-rectifier potassium channel proteins called potassium channel subfamily J. The encoded protein is a subunit of the potassium channel which is homotetrameric. It is controlled by G-proteins and has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Naturally occurring mutations in this gene are associated with aldosterone-producing adenomas. [provided by RefSeq, Aug 2017]'
• Protein Families: Druggable Genome, Ion Channels: Potassium, Transmembrane