SCARB1 (NM_005505) Human Mass Spec Standard

CAT#: PH310264

SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_005496)

Product Images

Coomassie blue staining of purified SCARB1 protein (Cat# TP310264). The protein was produced from HEK293T cells transfected with SCARB1 cDNA clone (Cat# RC210264) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210264
• Predicted MW: 56.8 kDa
• Protein Sequence:
  Sequence Link

  >RC210264 representing NM_005505
  Red=Cloning site Green=Tags(s)
  
  MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF
  DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL
  VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE
  LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC
  RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA
  DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG
  AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQEKCYLFWSSSKKGSKDKEAIQAY
  SESLMTSAPKGSVLQEAKL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005496
• RefSeq Size: 2759
• RefSeq ORF: 1527
• Synonyms: CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1
• Locus ID: 949
• UniProt ID: Q8WTV0, A0A024RBS4
• Cytogenetics: 12q24.31
• Summary: 'The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2019]'
• Protein Families: Druggable Genome, Transmembrane