SCARB1 (NM_005505) Human Recombinant Protein
CAT#: TP310264
Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 1
View other "SCARB1" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210264 representing NM_005505
Red=Cloning site Green=Tags(s) MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQEKCYLFWSSSKKGSKDKEAIQAY SESLMTSAPKGSVLQEAKL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 56.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005496 |
Locus ID | 949 |
UniProt ID | Q8WTV0, A0A024RBS4, F8W8N0 |
Cytogenetics | 12q24.31 |
Refseq Size | 2759 |
Refseq ORF | 1527 |
Synonyms | CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1 |
Summary | The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2019] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401684 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC421197 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LC425949 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401684 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 1 |
USD 396.00 |
|
LY421197 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 2 |
USD 605.00 |
|
LY425949 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 2 |
USD 396.00 |
|
PH310264 | SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_005496) |
USD 2,055.00 |
|
PH318270 | SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001076428) |
USD 2,055.00 |
|
TP318270 | Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review