SCARB1 (NM_005505) Human Recombinant Protein
CAT#: TP310264
Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210264 representing NM_005505
Red=Cloning site Green=Tags(s) MGCSAKARWAAGALGVAGLLCAVLGAVMIVMVPSLIKQQVLKNVRIDPSSLSFNMWKEIPIPFYLSVYFF DVMNPSEILKGEKPQVRERGPYVYREFRHKSNITFNNNDTVSFLEYRTFQFQPSKSHGSESDYIVMPNIL VLGAAVMMENKPMTLKLIMTLAFTTLGERAFMNRTVGEIMWGYKDPLVNLINKYFPGMFPFKDKFGLFAE LNNSDSGLFTVFTGVQNISRIHLVDKWNGLSKVDFWHSDQCNMINGTSGQMWPPFMTPESSLEFYSPEAC RSMKLMYKESGVFEGIPTYRFVAPKTLFANGSIYPPNEGFCPCLESGIQNVSTCRFSAPLFLSHPHFLNA DPVLAEAVTGLHPNQEAHSLFLDIHPVTGIPMNCSVKLQLSLYMKSVAGIGQTGKIEPVVLPLLWFAESG AMEGETLHTFYTQLVLMPKVMHYAQYVLLALGCVLLLVPVICQIRSQEKCYLFWSSSKKGSKDKEAIQAY SESLMTSAPKGSVLQEAKL myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 56.8 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_005496 |
| Locus ID | 949 |
| UniProt ID | Q8WTV0, A0A024RBS4, F8W8N0 |
| Cytogenetics | 12q24.31 |
| Refseq Size | 2759 |
| Refseq ORF | 1527 |
| Synonyms | CD36L1; CLA-1; CLA1; HDLQTL6; SR-BI; SRB1 |
| Summary | The protein encoded by this gene is a plasma membrane receptor for high density lipoprotein cholesterol (HDL). The encoded protein mediates cholesterol transfer to and from HDL. In addition, this protein is a receptor for hepatitis C virus glycoprotein E2. Several transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jan 2019] |
| Protein Families | Druggable Genome, Transmembrane |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401684 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421197 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
| LC425949 | SCARB1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY401684 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 1 |
USD 436.00 |
|
| LY421197 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 2 |
USD 665.00 |
|
| LY425949 | Transient overexpression lysate of scavenger receptor class B, member 1 (SCARB1), transcript variant 2 |
USD 396.00 |
|
| PH310264 | SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_005496) |
USD 2,055.00 |
|
| PH318270 | SCARB1 MS Standard C13 and N15-labeled recombinant protein (NP_001076428) |
USD 2,055.00 |
|
| TP318270 | Recombinant protein of human scavenger receptor class B, member 1 (SCARB1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China