GNA11 (NM_002067) Human Mass Spec Standard

CAT#: PH310292

GNA11 MS Standard C13 and N15-labeled recombinant protein (NP_002058)

Product Images

Coomassie blue staining of purified GNA11 protein (Cat# TP310292). The protein was produced from HEK293T cells transfected with GNA11 cDNA clone (Cat# RC210292) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210292
• Predicted MW: 42.1 kDa
• Protein Sequence:
  Sequence Link

  >RC210292 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEE
  DKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPG
  IQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQR
  SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE
  DKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ
  LNLKEYNLV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002058
• RefSeq Size: 4145
• RefSeq ORF: 1077
• Synonyms: FBH; FBH2; FHH2; GNA-11; HHC2; HYPOC2
• Locus ID: 2767
• UniProt ID: P29992
• Cytogenetics: 19p13.3
• Summary: 'The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations. [provided by RefSeq, Dec 2013]'
• Protein Pathways: Calcium signaling pathway, Gap junction, GnRH signaling pathway, Long-term depression, Vascular smooth muscle contraction