GNA11 (NM_002067) Human Recombinant Protein
CAT#: TP310292
Recombinant protein of human guanine nucleotide binding protein (G protein), alpha 11 (Gq class) (GNA11)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC210292 protein sequence
Red=Cloning site Green=Tags(s) MTLESMMACCLSDEVKESKRINAEIEKQLRRDKRDARRELKLLLLGTGESGKSTFIKQMRIIHGAGYSEE DKRGFTKLVYQNIFTAMQAMIRAMETLKILYKYEQNKANALLIREVDVEKVTTFEHQYVSAIKTLWEDPG IQECYDRRREYQLSDSAKYYLTDVDRIATLGYLPTQQDVLRVRVPTTGIIEYPFDLENIIFRMVDVGGQR SERRKWIHCFENVTSIMFLVALSEYDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLE DKILYSHLVDYFPEFDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQ LNLKEYNLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 41.9 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_002058 |
| Locus ID | 2767 |
| UniProt ID | P29992 |
| Cytogenetics | 19p13.3 |
| Refseq Size | 4145 |
| Refseq ORF | 1077 |
| Synonyms | FBH; FBH2; FHH2; GNA-11; HHC2; HYPOC2 |
| Summary | The protein encoded by this gene belongs to the family of guanine nucleotide-binding proteins (G proteins), which function as modulators or transducers in various transmembrane signaling systems. G proteins are composed of 3 units: alpha, beta and gamma. This gene encodes one of the alpha subunits (subunit alpha-11). Mutations in this gene have been associated with hypocalciuric hypercalcemia type II (HHC2) and hypocalcemia dominant 2 (HYPOC2). Patients with HHC2 and HYPOC2 exhibit decreased or increased sensitivity, respectively, to changes in extracellular calcium concentrations. [provided by RefSeq, Dec 2013] |
| Protein Pathways | Calcium signaling pathway, Gap junction, GnRH signaling pathway, Long-term depression, Vascular smooth muscle contraction |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC419559 | GNA11 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY419559 | Transient overexpression lysate of guanine nucleotide binding protein (G protein), alpha 11 (Gq class) (GNA11) |
USD 436.00 |
|
| PH310292 | GNA11 MS Standard C13 and N15-labeled recombinant protein (NP_002058) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China