SHARP2 (BHLHE40) (NM_003670) Human Mass Spec Standard

CAT#: PH310294

BHLHE40 MS Standard C13 and N15-labeled recombinant protein (NP_003661)

Product Images

Coomassie blue staining of purified BHLHE40 protein (Cat# TP310294). The protein was produced from HEK293T cells transfected with BHLHE40 cDNA clone (Cat# RC210294) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210294
• Predicted MW: 45.5 kDa
• Protein Sequence:
  Sequence Link

  >RC210294 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINE
  CIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQE
  MFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAK
  GSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQ
  ESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPV
  LYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003661
• RefSeq Size: 3061
• RefSeq ORF: 1236
• Synonyms: BHLHB2; Clast5; DEC1; HLHB2; SHARP-2; SHARP2; STRA13; Stra14
• Locus ID: 8553
• UniProt ID: O14503, Q6IB83
• Cytogenetics: 3p26.1
• Summary: This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. [provided by RefSeq, Feb 2014]
• Protein Families: Transcription Factors
• Protein Pathways: Circadian rhythm - mammal