SHARP2 (BHLHE40) (NM_003670) Human Recombinant Protein

CAT#: TP310294

Recombinant protein of human basic helix-loop-helix family, member e40 (BHLHE40)

Product Images

Coomassie blue staining of purified BHLHE40 protein (Cat# TP310294). The protein was produced from HEK293T cells transfected with BHLHE40 cDNA clone (Cat# RC210294) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210294 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MERIPSAQPPPACLPKAPGLEHGDLPGMYPAHMYQVYKSRRGIKRSEDSKETYKLPHRLIEKKRRDRINE
  CIAQLKDLLPEHLKLTTLGHLEKAVVLELTLKHVKALTNLIDQQQQKIIALQSGLQAGELSGRNVETGQE
  MFCSGFQTCAREVLQYLAKHENTRDLKSSQLVTHLHRVVSELLQGGTSRKPSDPAPKVMDFKEKPSSPAK
  GSEGPGKNCVPVIQRTFAHSSGEQSGSDTDTDSGYGGESEKGDLRSEQPCFKSDHGRRFTMGERIGAIKQ
  ESEEPPTKKNRMQLSDDEGHFTSSDLISSPFLGPHPHQPPFCLPFYLIPPSATAYLPMLEKCWYPTSVPV
  LYPGLNASAAALSSFMNPDKISAPLLMPQRLPSPLPAHPSVDSSVLLQALKPIPPLNLETKD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_003661
• Locus ID: 8553
• UniProt ID: O14503, Q6IB83
• Cytogenetics: 3p26.1
• Refseq Size: 3061
• Refseq ORF: 1236
• Synonyms: BHLHB2; Clast5; DEC1; HLHB2; SHARP-2; SHARP2; STRA13; Stra14
• Summary: This gene encodes a basic helix-loop-helix protein expressed in various tissues. The encoded protein can interact with ARNTL or compete for E-box binding sites in the promoter of PER1 and repress CLOCK/ARNTL's transactivation of PER1. This gene is believed to be involved in the control of circadian rhythm and cell differentiation. [provided by RefSeq, Feb 2014]
• Protein Families: Transcription Factors
• Protein Pathways: Circadian rhythm - mammal