NPTN (NM_017455) Human Mass Spec Standard

CAT#: PH310326

NPTN MS Standard C13 and N15-labeled recombinant protein (NP_059429)

Product Images

Coomassie blue staining of purified NPTN protein (Cat# TP310326). The protein was produced from HEK293T cells transfected with NPTN cDNA clone (Cat# RC210326) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC210326
• Predicted MW: 31.3 kDa
• Protein Sequence:
  Sequence Link

  >RC210326 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGSSLPSALALSLLLVSGSLLPGPGAAQNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTK
  NGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAT
  MYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSAS
  VVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRN
  TN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_059429
• RefSeq Size: 2106
• RefSeq ORF: 846
• Synonyms: GP55; GP65; np55; np65; SDFR1; SDR1
• Locus ID: 27020
• UniProt ID: Q9Y639
• Cytogenetics: 15q24.1
• Summary: This gene encodes a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009]
• Protein Families: Druggable Genome, Transmembrane