NPTN (NM_017455) Human Recombinant Protein
CAT#: TP310326
Recombinant protein of human neuroplastin (NPTN), transcript variant alpha
View other "NPTN" proteins (8)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC210326 protein sequence
Red=Cloning site Green=Tags(s) MSGSSLPSALALSLLLVSGSLLPGPGAAQNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTK NGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAT MYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSAS VVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRN TN myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 28.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_059429 |
Locus ID | 27020 |
UniProt ID | Q9Y639 |
Cytogenetics | 15q24.1 |
Refseq Size | 2106 |
Refseq ORF | 846 |
Synonyms | GP55; GP65; np55; np65; SDFR1; SDR1 |
Summary | This gene encodes a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413759 | NPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431237 | NPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431345 | NPTN HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY413759 | Transient overexpression lysate of neuroplastin (NPTN), transcript variant a |
USD 396.00 |
|
LY431237 | Transient overexpression lysate of neuroplastin (NPTN), transcript variant d |
USD 396.00 |
|
LY431345 | Transient overexpression lysate of neuroplastin (NPTN), transcript variant c |
USD 396.00 |
|
PH310326 | NPTN MS Standard C13 and N15-labeled recombinant protein (NP_059429) |
USD 2,055.00 |
|
TP720412 | Recombinant protein of human neuroplastin (NPTN), transcript variant c. |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review