NPTN (NM_017455) Human Recombinant Protein

CAT#: TP310326

Recombinant protein of human neuroplastin (NPTN), transcript variant alpha

Product Images

Coomassie blue staining of purified NPTN protein (Cat# TP310326). The protein was produced from HEK293T cells transfected with NPTN cDNA clone (Cat# RC210326) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC210326 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSGSSLPSALALSLLLVSGSLLPGPGAAQNEPRIVTSEEVIIRDSPVLPVTLQCNLTSSSHTLTYSYWTK
  NGVELSATRKNASNMEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKNEGQDAT
  MYCKSVGYPHPDWIWRKKENGMPMDIVNTSGRFFIINKENYTELNIVNLQITEDPGEYECNATNAIGSAS
  VVTVLRVRSHLAPLWPFLGILAEIIILVVIIVVYEKRKRPDEVPDDDEPAGPMKTNSTNNHKDKNLRQRN
  TN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 28.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_059429
• Locus ID: 27020
• UniProt ID: Q9Y639
• Cytogenetics: 15q24.1
• Refseq Size: 2106
• Refseq ORF: 846
• Synonyms: GP55; GP65; np55; np65; SDFR1; SDR1
• Summary: This gene encodes a type I transmembrane protein belonging to the Ig superfamily. The protein is believed to be involved in cell-cell interactions or cell-substrate interactions. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2009]
• Protein Families: Druggable Genome, Transmembrane